
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Others
Uniprot ID: Q8Z7S0
Gene Names: ompA
Organism: Salmonella typhi
AA Sequence: TWYAGAKLGWSQYHDTGFIHNDGPTHENQLGAGAFGGYQVNPYVGFEMGYDWLGRMPYKGDNTNGAYKAQGVQLTAKLGYPITDDLDVYTRLGGMVWRADTKSNVPGGASTKDHDTGVSPVFAGGIEYAITPEIATRLEYQWTNNIGDANTIGTRPDNGLLSVGVSYRFGQQEAAPVVAPAPAPAPEVQTKHFTLKSDVLFNFNKSTLKPEGQQALDQLYSQLSNLDPKDGSVVVLGFTDRIGSDAYNQGLSEKRAQSVVDYLISKGIPSDKISARGMGESNPVTGNTCDNVKPRAALIDCLAPDRRVEIEVKGVKDVVTQPQ
Expression Region: 27-349aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 38.9 kDa
Alternative Name(s):
Relevance: Required for the action of colicins K and L and for the stabilization of mating aggregates in conjugation. Serves as a receptor for a number of T-even like phages. Also acts as a porin with low permeability that allows slow penetration of small solutes .
Reference: Complete genome sequence of a multiple drug resistant Salmonella enterica serovar Typhi CT18.Parkhill J., Dougan G., James K.D., Thomson N.R., Pickard D., Wain J., Churcher C.M., Mungall K.L., Bentley S.D., Holden M.T.G., Sebaihia M., Baker S., Basham D., Brooks K., Chillingworth T., Connerton P., Cronin A., Davis P. , Davies R.M., Dowd L., White N., Farrar J., Feltwell T., Hamlin N., Haque A., Hien T.T., Holroyd S., Jagels K., Krogh A., Larsen T.S., Leather S., Moule S., O'Gaora P., Parry C., Quail M.A., Rutherford K.M., Simmonds M., Skelton J., Stevens K., Whitehead S., Barrell B.G.Nature 413:848-852(2001)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Salmonella typhi Outer membrane protein A(ompA),partial
- Regular price
- ¥158,100 JPY
- Sale price
- ¥158,100 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Salmonella typhimurium Outer membrane porin protein OmpD(ompD)
- Regular price
- ¥158,100 JPY
- Sale price
- ¥158,100 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Escherichia coli Outer membrane protein A(ompA),partial
- Regular price
- ¥158,100 JPY
- Sale price
- ¥158,100 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Salmonella typhi Protein viaA(viaA),partial
- Regular price
- ¥158,100 JPY
- Sale price
- ¥158,100 JPY
- Regular price
-
- Unit price
- per
Sold out