Skip to product information
1 of 1

Gene Bio Systems

Recombinant Salmonella paratyphi C UPF0266 membrane protein yobD(yobD)

Recombinant Salmonella paratyphi C UPF0266 membrane protein yobD(yobD)

SKU:CSB-CF505755SWU

Regular price ¥260,200 JPY
Regular price Sale price ¥260,200 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Salmonella paratyphi C (strain RKS4594)

Uniprot NO.:C0Q301

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTITDLLLILFIAALLAYALYDQFIMPRRNGPTLLSIALLRRGRVDSVIFVGLVAILIYN NVTSHGAQMTTWLLSALALMGFYIFWIRTPRIIFKQRGFFFANVWIEYNRIKEMNLSEDG VLVMQLEQRRLLIRVRNIDDLEKIYKLLIENQ

Protein Names:Recommended name: UPF0266 membrane protein yobD

Gene Names:Name:yobD Ordered Locus Names:SPC_1896

Expression Region:1-152

Sequence Info:full length protein

View full details