Gene Bio Systems
Recombinant Salmonella newport UPF0442 protein yjjB(yjjB)
Recombinant Salmonella newport UPF0442 protein yjjB(yjjB)
SKU:CSB-CF479147SWS
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Salmonella newport (strain SL254)
Uniprot NO.:B4T4F0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MGIIDFLLALMQDMILSAIPAVGFAMVFNVPHRALPWCALLGALGHGSRMLMMSAGFNIE WSTFMASLLVGSIGIQWSRWYLAHPKVFTVAAVIPMFPGISAYTAMISAVKISHLGYSEP MMITLLTNFLKASSIVGALSIGLSVPGLWLYRKRPRV
Protein Names:Recommended name: UPF0442 protein yjjB
Gene Names:Name:yjjB Ordered Locus Names:SNSL254_A4900
Expression Region:1-157
Sequence Info:full length protein
