Skip to product information
1 of 1

Gene Bio Systems

Recombinant Salmonella gallinarum UPF0299 membrane protein yohJ(yohJ)

Recombinant Salmonella gallinarum UPF0299 membrane protein yohJ(yohJ)

SKU:CSB-CF473498SWP

Regular price ¥264,500 JPY
Regular price Sale price ¥264,500 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Salmonella gallinarum (strain 287/91 / NCTC 13346)

Uniprot NO.:B5RC20

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSKSLNIIWQYIRAFVLIYACLYAGIFLASLLPITIPGSIIGMLILFVLLALQILPAKWV NPGCYVLIRYMALLFVPIGVGVMQYFDLLRAQFGPVVVSCAISTLVVFVVVSWSSHLIHG ERKVVGQKGTKK

Protein Names:Recommended name: UPF0299 membrane protein yohJ

Gene Names:Name:yohJ Ordered Locus Names:SG2217

Expression Region:1-132

Sequence Info:full length protein

View full details