Recombinant Salmo salar Vertebrate ancient opsin,partial

SKU: CSB-CF517517SWI

Size: 10ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 15-20 working days

Research Topic: Others

Uniprot ID: O13018

Gene Names: N/A

Organism: Salmo salar(Atlantic salmon)

AA Sequence: MDTLRIAVNGVSYNEASEIYKPHADPFTGPITNLAPWNFAVLATLMFVITSLSLFENFTVMLATYKFKQLRQPLN

Expression Region: 1-75aa

Sequence Info: Partial

Source: in vitro E.coli expression system

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 24.5 kDa

Alternative Name(s):

Relevance:

Reference: "A novel and ancient vertebrate opsin."Soni B.G., Foster R.G.FEBS Lett. 406:279-283(1997)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer，50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.