Recombinant Saccharum officinarum Sucrose synthase(SUS1)

SKU: CSB-EP335680SVV

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P31925

Gene Names: SUS1

Organism: Saccharum officinarum (Sugarcane)

AA Sequence: ARLDRVKNMTGPVEISGKKARLRELANPVIVAGDHGKESKDRDEAEEQGGFKKMYSLIDDYKFKGHIRLISAQMNRVRNGELYQYICDTKGAFVQPAYEAFRLDCDRVHEVRSAKDRDLPWRPCEIIADGVSGLHIDPYHSDKDADILVNFFDKCNADPSYWDEISQGGQRIYEKYTWKLYSERLMTLTGAYGFWNYVSKLERGDTRYIDMFYALEYP

Expression Region: 1-218aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 41.3 kDa

Alternative Name(s): Sucrose-UDP glucosyltransferase

Relevance: Sucrose-cleaving enzyme that provides UDP-glucose and fructose for various metabolic pathways.

Reference: "Amplification and cloning of sugarcane sucrose synthase cDNA by anchored PCR."Kumar A.S., Moore P.H., Maretzki A.PCR Methods Appl. 2:70-75(1992)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer，50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.