Skip to product information
1 of 1

Gene Bio Systems

Recombinant Saccharum hybrid Cytochrome b6-f complex subunit 4(petD)

Recombinant Saccharum hybrid Cytochrome b6-f complex subunit 4(petD)

SKU:CSB-CF740337SAN

Regular price ¥269,000 JPY
Regular price Sale price ¥269,000 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Saccharum hybrid (Sugarcane)

Uniprot NO.:Q6L371

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGVTKKPDLNDPVLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACNVGLAVLEPS MIGEPADPFATPLEILPEWYFFPVFQILRTVPNKLLGVLLMVSVPTGLLTVPFLENVNKF QNPFRRPVATTVFLIGTAVALWLGIGATLPIDKSLTLGLF

Protein Names:Recommended name: Cytochrome b6-f complex subunit 4 Alternative name(s): 17 kDa polypeptide

Gene Names:Name:petD Ordered Locus Names:PS156

Expression Region:1-160

Sequence Info:full length protein

View full details