Gene Bio Systems
Recombinant Saccharophagus degradans Protein CrcB homolog(crcB)
Recombinant Saccharophagus degradans Protein CrcB homolog(crcB)
SKU:CSB-CF630397SAAX
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Uniprot NO.:Q21K23
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTSAVPATSLILWLAVALGGALGALARYSVSIAWMPAQLKFPVATLTVNVLGSFLMGVFY VVIVEKAMLAPVWRHVIMIGFLGAFTTFSTFSIESLHLWQSGHWQIAISYVVANVVLSIS AVVVAIVLTEKLV
Protein Names:Recommended name: Protein CrcB homolog
Gene Names:Name:crcB Ordered Locus Names:Sde_1696
Expression Region:1-133
Sequence Info:full length protein
