Gene Bio Systems
Recombinant Saccharomyces cerevisiae V-type proton ATPase subunit e(VMA9)
Recombinant Saccharomyces cerevisiae V-type proton ATPase subunit e(VMA9)
SKU:CSB-CF659040SVG
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Uniprot NO.:Q3E7B6
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSSFYTVVGVFIVVSAMSVLFWIMAPKNNQAVWRSTVILTLAMMFLMWAITFLCQLHPLV APRRSDLRPEFAE
Protein Names:Recommended name: V-type proton ATPase subunit e Short name= V-ATPase subunit e Alternative name(s): Low dye-binding protein 10 Vacuolar proton pump subunit e
Gene Names:Name:VMA9 Synonyms:CWH36, LDB10 Ordered Locus Names:YCL005W-A
Expression Region:1-73
Sequence Info:full length protein
