
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Uniprot NO.:P47087
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTVQSSPILRQSSFNFITFYLACQLLTFLCIYIVFFFVKFLPTIKVSFIIIGACKRAPHV SVYLLKIDCEHNESSMAAGGELSYEELLDHILNNKPIPNIVEVPNVTLDEGLASTPSLRP RPRPWEGQLQHQSHQGSLDKPNISLDIDQESLEGMTSLTRLSECYDIQSKLQINDSDNDN DDNNNDNNKGDGNDDDNNTVTANPTAR
Protein Names:Recommended name: Uncharacterized protein YJR012C
Gene Names:Ordered Locus Names:YJR012C ORF Names:J1440, YJR83.25
Expression Region:1-207
Sequence Info:full length protein
You may also like
-
Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YFR012W (YFR012W)
- Regular price
- ¥176,400 JPY
- Sale price
- ¥176,400 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YDR401W (YDR401W)
- Regular price
- ¥176,800 JPY
- Sale price
- ¥176,800 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YJR018W (YJR018W)
- Regular price
- ¥168,700 JPY
- Sale price
- ¥168,700 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YAL042C-A (YAL042C-A)
- Regular price
- ¥169,300 JPY
- Sale price
- ¥169,300 JPY
- Regular price
-
- Unit price
- per
Sold out