Recombinant Saccharomyces cerevisiae Serine palmitoyltransferase-regulating protein TSC3(TSC3)

SKU: CSB-CF660343SVG

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Uniprot NO.:Q3E790

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTQHKSSMVYIPTTKEAKRRNGKSEGILNTIEEVVEKLYWTYYIHLPFYLMASFDSFFLH VFFLTIFSLSFFGILKYCFL

Protein Names:Recommended name: Serine palmitoyltransferase-regulating protein TSC3 Alternative name(s): Temperature-sensitive CSG2-mutant suppressor protein 3

Gene Names:Name:TSC3 Ordered Locus Names:YBR058C-A

Expression Region:1-80

Sequence Info:full length protein