Skip to product information
1 of 1

Gene Bio Systems

Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YPR130C (YPR130C)

Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YPR130C (YPR130C)

SKU:CSB-CF519280SVG

Regular price ¥263,700 JPY
Regular price Sale price ¥263,700 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Uniprot NO.:O13568

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MYILNDILNLHRNIILKFNVGRRLRKLVGWSAVRVVLVLIGATIILVVISVLVVSTLAAS SSVSSVSPIISTPTTEASRVKSWSGRSLSKGVNVQHFFFLPSHIGISFSRSGDGVEKRRF FIIKLLIRFILLVNS

Protein Names:Recommended name: Putative uncharacterized protein YPR130C

Gene Names:Ordered Locus Names:YPR130C ORF Names:P9659.10A

Expression Region:1-135

Sequence Info:full length protein

View full details