Gene Bio Systems
Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YNR005C (YNR005C)
Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YNR005C (YNR005C)
SKU:CSB-CF346881SVG
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Uniprot NO.:P53717
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MVFTSSESSSLLSSLKMTCSMVSMNSLEQISLIKGVPPFFTHILVSFQEDNWVFGLSAVL RILFFIQRIESLGFTLLDLNTSEISNAMGRSRSPLGMLSLVACSINASNSLGVLTDILFL VLYSLLIHLSKKKS
Protein Names:Recommended name: Putative uncharacterized protein YNR005C
Gene Names:Ordered Locus Names:YNR005C ORF Names:N2036
Expression Region:1-134
Sequence Info:full length protein
