Skip to product information
1 of 1

Gene Bio Systems

Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YJR018W (YJR018W)

Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YJR018W (YJR018W)

SKU:CSB-CF344432SVG

Regular price ¥226,900 JPY
Regular price Sale price ¥226,900 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Uniprot NO.:P47091

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MFSDLCDAGLLESLCLMRMCRHLTRTGWSLKCLCSWSLLVPSGSSHCECFVSGLKKYSLF LDLLYLTVHGVGSPVLDATSDGIGASLWCRSRLCVGISTTMIIQVLFLLRSKGKRYDTRS

Protein Names:Recommended name: Putative uncharacterized protein YJR018W

Gene Names:Ordered Locus Names:YJR018W ORF Names:J1454, YJR83.14

Expression Region:1-120

Sequence Info:full length protein

View full details