Skip to product information
1 of 1

Gene Bio Systems

Recombinant Saccharomyces cerevisiae Protein YIP4(YIP4)

Recombinant Saccharomyces cerevisiae Protein YIP4(YIP4)

SKU:CSB-CF347168SVG

Regular price ¥282,400 JPY
Regular price Sale price ¥282,400 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Uniprot NO.:P53093

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSYGREDTTIEPDFIEPDAPLAASGGVADNIGGTMQNSGSRGTLDETVLQTLKRDVVEIN SRLKQVVYPHFPSFFSPSDDGIGAADNDISANCDLWAPLAFIILYSLFVSHARSLFSSLF VSSWFILLVMALHLRLTKPHQRVSLISYISISGYCLFPQVLNALVSQILLPLAYHIGKQN RWIVRVLSLVKLVVMALCLMWSVAAVSWVTKSKTIIEIYPLALCLFGMAWLSTIL

Protein Names:Recommended name: Protein YIP4 Alternative name(s): YPT-interacting protein 4

Gene Names:Name:YIP4 Ordered Locus Names:YGL198W ORF Names:G1304

Expression Region:1-235

Sequence Info:full length protein

View full details