Skip to product information
1 of 1

Gene Bio Systems

Recombinant Saccharomyces cerevisiae Protein SVP26(SVP26)

Recombinant Saccharomyces cerevisiae Protein SVP26(SVP26)

SKU:CSB-CF330948SVG

Regular price ¥282,000 JPY
Regular price Sale price ¥282,000 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Uniprot NO.:P38869

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLLELISYAGTVSGFLFLTLSIASGLYYISELVEEHTEPTRRFLTRAIYGIILILILLLL LDGFPFKLTLFSIACYIVYYQNLKSFPFISLTSPTFLLSCVCVVLNHYFWFKYFNDTEVP PQFKFDPNYIPRRRASFAEVASFFGICVWFIPFALFVSLSAGDYVLPTTSEQHMAKKNDD ITTNNQPKFRKRAVGLARVVINSVRKYIYSLARVFGYEIEPDFDRLAV

Protein Names:Recommended name: Protein SVP26 Alternative name(s): Sed5 compartment vesicle protein of 26 kDa

Gene Names:Name:SVP26 Ordered Locus Names:YHR181W

Expression Region:1-228

Sequence Info:full length protein

View full details