Skip to product information
1 of 1

Gene Bio Systems

Recombinant Saccharomyces cerevisiae Protein ROT1(ROT1)

Recombinant Saccharomyces cerevisiae Protein ROT1(ROT1)

SKU:CSB-CF409729STA

Regular price ¥275,700 JPY
Regular price Sale price ¥275,700 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Saccharomyces cerevisiae (strain YJM789) (Baker's yeast)

Uniprot NO.:A6ZMR2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:EDESNSIYGTWSSKSNQVFTGPGFYDPVDELLIEPSLPGLSYSFTEDGWYEEATYQVSGN PRNPTCPMASLIYQHGTYNISENGTLVLNPIEVDGRQLFSDPCNDDGVSTYSRYNQTETF KEYAVGIDPYHGIYTLQLYQYDGTPMQPLYLAYRPPMMLPTETLNPTSSATSTDDSSSNK KRSLRSLVRRSLENRHKTNAIKRQNTSFLTSNAIWYISAGMLGVGSLLFLAF

Protein Names:Recommended name: Protein ROT1 Alternative name(s): Reversal of TOR2 lethality protein 1

Gene Names:Name:ROT1 ORF Names:SCY_4378

Expression Region:25-256

Sequence Info:full length protein

View full details