Skip to product information
1 of 1

Gene Bio Systems

Recombinant Saccharomyces cerevisiae Nuclear membrane organization protein APQ12(APQ12)

Recombinant Saccharomyces cerevisiae Nuclear membrane organization protein APQ12(APQ12)

SKU:CSB-CF340269SVG

Regular price ¥265,100 JPY
Regular price Sale price ¥265,100 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Uniprot NO.:P40532

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDATQPQYELSVVTQCLKSAIDVIQWLIPTITKFSQSHPLVFQLLFIFFTFYVFYKLLMN FITLVKRFLYLTLVVTCIGIYMRGSQQFLTVDLLNFYNFVMSNRYYAFKIYTLFINALER EINTVYHLAQMKMEQLLK

Protein Names:Recommended name: Nuclear membrane organization protein APQ12

Gene Names:Name:APQ12 Ordered Locus Names:YIL040W

Expression Region:1-138

Sequence Info:full length protein

View full details