Skip to product information
1 of 1

Gene Bio Systems

Recombinant Saccharomyces cerevisiae Mitochondrial inner membrane protease subunit 2(IMP2)

Recombinant Saccharomyces cerevisiae Mitochondrial inner membrane protease subunit 2(IMP2)

SKU:CSB-CF011689SVG

Regular price ¥271,700 JPY
Regular price Sale price ¥271,700 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Uniprot NO.:P46972

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MFRAGSSKRFLRNTLIAISWVPVLLTINNNVVHIAQVKGTSMQPTLNPQTETLATDWVLL WKFGVKNPSNLSRDDIILFKAPTNPRKVYCKRVKGLPFDTIDTKFPYPKPQVNLPRGHIW VEGDNYFHSIDSNTFGPISSGLVIGKAITIVWPPSRWGTDLKLSTGRDCISKRAILE

Protein Names:Recommended name: Mitochondrial inner membrane protease subunit 2 EC= 3.4.21.-

Gene Names:Name:IMP2 Ordered Locus Names:YMR035W ORF Names:YM9973.09

Expression Region:1-177

Sequence Info:full length protein

View full details