Gene Bio Systems
Recombinant Saccharomyces cerevisiae killer virus M1 M1-1 protoxin
Recombinant Saccharomyces cerevisiae killer virus M1 M1-1 protoxin
SKU:CSB-CF355678SAD
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Saccharomyces cerevisiae killer virus M1 (ScV-M1) (Saccharomyces cerevisiae virus M1)
Uniprot NO.:P01546
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:YVYPMCEHGIKASYCMALNDAMVSANGNLYGLAEKLFSEDEGQWETNYYKLYWSTGQWIM SMKFIEESIDNANNDFEGCDTGH
Protein Names:Recommended name: M1-1 protoxin Alternative name(s): Killer toxin K1 Cleaved into the following 4 chains: 1. M1-1 delta chain 2. M1-1 alpha chain 3. M1-1 gamma immunity chain 4. M1-1 beta chain
Gene Names:
Expression Region:234-316
Sequence Info:full length protein
