Skip to product information
1 of 1

Gene Bio Systems

Recombinant Saccharomyces cerevisiae killer virus M1 M1-1 protoxin

Recombinant Saccharomyces cerevisiae killer virus M1 M1-1 protoxin

SKU:CSB-CF355678SAD

Regular price ¥248,300 JPY
Regular price Sale price ¥248,300 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Saccharomyces cerevisiae killer virus M1 (ScV-M1) (Saccharomyces cerevisiae virus M1)

Uniprot NO.:P01546

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:YVYPMCEHGIKASYCMALNDAMVSANGNLYGLAEKLFSEDEGQWETNYYKLYWSTGQWIM SMKFIEESIDNANNDFEGCDTGH

Protein Names:Recommended name: M1-1 protoxin Alternative name(s): Killer toxin K1 Cleaved into the following 4 chains: 1. M1-1 delta chain 2. M1-1 alpha chain 3. M1-1 gamma immunity chain 4. M1-1 beta chain

Gene Names:

Expression Region:234-316

Sequence Info:full length protein

View full details