Gene Bio Systems
Recombinant Saccharomyces cerevisiae Golgi apparatus membrane protein TVP18(TVP18)
Recombinant Saccharomyces cerevisiae Golgi apparatus membrane protein TVP18(TVP18)
SKU:CSB-CF312029SVG
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Uniprot NO.:Q04767
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MALSLGQFINVGGMVKDLKSFNFSVYGRWFGYINIILCIALGIANLFHVSGVIAFGIISI IQGLVILFIEIPFLLKICPLSDNFIEFIKRFETNGWRCLFYLAMAIIQYISIAVMATSLI VVAVGLTISSISYAVAYTKHQEFQNTNIIKNPTDDDFPHEAVVREML
Protein Names:Recommended name: Golgi apparatus membrane protein TVP18 Alternative name(s): TLG2 compartment vesicle protein of 18 kDa
Gene Names:Name:TVP18 Ordered Locus Names:YMR071C ORF Names:YM9916.10C
Expression Region:1-167
Sequence Info:full length protein
