Skip to product information
1 of 1

Gene Bio Systems

Recombinant Saccharomyces cerevisiae Dolichyl-phosphate beta-glucosyltransferase(ALG5)

Recombinant Saccharomyces cerevisiae Dolichyl-phosphate beta-glucosyltransferase(ALG5)

SKU:CSB-CF001602SVG

Regular price ¥297,000 JPY
Regular price Sale price ¥297,000 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Uniprot NO.:P40350

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRALRFLIENRNTVFFTLLVALVLSLYLLVYLFSHTPRPPYPEELKYIAIDEKGHEVSRALPNLNEHQDDEEIFLSVVIPSYNETGRILLMLTDAISFLKEKYGSRWEIVIVDDGSTDNTTQYCLKICKEQFKLNYEQFRIIKFSQNRGKGGAVRQGFLHIRGKYGLFADADGASKFSDVEKLIDAISKIETSSTDLKTTKPAVAIGSRAHMVNTEAVIKRSMIRNCLMYGFHTLVFIFGIRSIKDTQCGFKLFNRAAILKIFPYLHTEGWIFDVEILILAIRKRIQIEEIPISWHEVDGSKMALAIDSIKMAKDLVIIRMAYLLGIYRDNKKC

Protein Names:Recommended name: Dolichyl-phosphate beta-glucosyltransferase Short name= DolP-glucosyltransferase EC= 2.4.1.117 Alternative name(s): Asparagine-linked glycosylation protein 5

Gene Names:Name:ALG5 Ordered Locus Names:YPL227C ORF Names:P1437

Expression Region:1-334

Sequence Info:full length protein

View full details