Skip to product information
1 of 1

Gene Bio Systems

Recombinant Saccharomyces cerevisiae Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit OST5(OST5)

Recombinant Saccharomyces cerevisiae Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit OST5(OST5)

SKU:CSB-CF842104SVG

Regular price ¥255,900 JPY
Regular price Sale price ¥255,900 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Uniprot NO.:Q92316

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTYEQLYKEFHSSKSFQPFIHLDTQPKFAICGLIVTLAVLSSALFAVGSKSSYIKKLFFY TILSVIGSLFAGLTTVFASNSFGVYV

Protein Names:Recommended name: Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit OST5 Short name= Oligosaccharyl transferase subunit OST5 EC= 2.4.1.119 Alternative name(s): Oligosaccharyl transferase 9.5 kDa subunit Oligo

Gene Names:Name:OST5 Ordered Locus Names:YGL226C-A ORF Names:YGL226BC

Expression Region:1-86

Sequence Info:full length protein

View full details