Gene Bio Systems
Recombinant Saccharomyces cerevisiae Dolichol-phosphate mannosyltransferase(DPM1)
Recombinant Saccharomyces cerevisiae Dolichol-phosphate mannosyltransferase(DPM1)
SKU:CSB-CF007134SVG
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Uniprot NO.:P14020
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:SIEYSVIVPAYHEKLNIKPLTTRLFAGMSPEMAKKTELIFVDDNSQDGSVEEVDALAHQGYNVRIIVRTNERGLSSAVLKGFYEAKGQYLVCMDADLQHPPETVPKLFESLHDHAFTLGTRYAPGVGIDKDWPMYRRVISSTARMMARPLTIASDPMSGFFGLQKKYLENCNPRDINSQGFKIALELLAKLPLPRDPRVAIGEVPFTFGVRTEGESKLSGKVIIQYLQQLKELYVFKFGANNLILFITFWSILFFYVCYQLYHLVF
Protein Names:Recommended name: Dolichol-phosphate mannosyltransferase EC= 2.4.1.83 Alternative name(s): Dolichol-phosphate mannose synthase Short name= DPM synthase Dolichyl-phosphate beta-D-mannosyltransferase Mannose-P-dolichol synthase Short name= MPD synthase
Gene Names:Name:DPM1 Synonyms:SED3 Ordered Locus Names:YPR183W ORF Names:P9705.3
Expression Region:2-267
Sequence Info:full length protein
