Skip to product information
1 of 1

Gene Bio Systems

Recombinant Saccharomyces cerevisiae Cytochrome oxidase assembly protein 3, mitochondrial(COA3)

Recombinant Saccharomyces cerevisiae Cytochrome oxidase assembly protein 3, mitochondrial(COA3)

SKU:CSB-CF668178SVG

Regular price ¥220,600 JPY
Regular price Sale price ¥220,600 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Uniprot NO.:Q3E7B2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVLNPSKYQDTRTWKMTPAMIRARKPFFKGNMLGLTLLLGVTGSVYYYTYHFLHKDNDFA DVPIPPIDPQELEALKKEYEAKKKA

Protein Names:Recommended name: Cytochrome oxidase assembly protein 3, mitochondrial Alternative name(s): Cytochrome oxidase protein 10 Required for respiratory growth protein 10

Gene Names:Name:COA3 Synonyms:COX25, RRG10 Ordered Locus Names:YJL062W-A

Expression Region:1-85

Sequence Info:full length protein

View full details