Gene Bio Systems
Recombinant Saccharomyces cerevisiae Cytochrome b-c1 complex subunit 9(QCR9)
Recombinant Saccharomyces cerevisiae Cytochrome b-c1 complex subunit 9(QCR9)
SKU:CSB-CF322128SVG
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Uniprot NO.:P22289
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:SFSSLYKTFFKRNAVFVGTIFAGAFVFQTVFDTAITSWYENHNKGKLWKDVKARIAAGDG DDDDE
Protein Names:Recommended name: Cytochrome b-c1 complex subunit 9 Alternative name(s): Complex III subunit 9 Complex III subunit X Cytochrome c1 non-heme 7.3 kDa protein Ubiquinol-cytochrome c reductase complex 7.3 kDa protein
Gene Names:Name:QCR9 Synonyms:UCR9 Ordered Locus Names:YGR183C
Expression Region:2-66
Sequence Info:full length protein
