Recombinant Saccharomyces cerevisiae Cytochrome b-c1 complex subunit 9(QCR9)

SKU: CSB-CF322128SVG

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Uniprot NO.:P22289

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:SFSSLYKTFFKRNAVFVGTIFAGAFVFQTVFDTAITSWYENHNKGKLWKDVKARIAAGDG DDDDE

Protein Names:Recommended name: Cytochrome b-c1 complex subunit 9 Alternative name(s): Complex III subunit 9 Complex III subunit X Cytochrome c1 non-heme 7.3 kDa protein Ubiquinol-cytochrome c reductase complex 7.3 kDa protein

Gene Names:Name:QCR9 Synonyms:UCR9 Ordered Locus Names:YGR183C

Expression Region:2-66

Sequence Info:full length protein