Gene Bio Systems
Recombinant Saccharomyces cerevisiae Altered inheritance of mitochondria protein 11(AIM11)
Recombinant Saccharomyces cerevisiae Altered inheritance of mitochondria protein 11(AIM11)
SKU:CSB-CF509787SVL
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Saccharomyces cerevisiae (strain JAY291) (Baker's yeast)
Uniprot NO.:C7GRS7
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MIEEKKELKKRRVLQMARFYGAAAFTLITMRLISRAIKVRKCNVPSIFQQNYKLPPFSQR NEAMSALTYASAASIGTFSTLIFGFCWALDISTAREFVFKTREFMSLPQALETDTSMDEE TSKLTKQLQDLLSSENNK
Protein Names:Recommended name: Altered inheritance of mitochondria protein 11 Alternative name(s): Genetic interactor of prohibitins 8
Gene Names:Name:AIM11 Synonyms:GEP8 ORF Names:C1Q_03034
Expression Region:1-138
Sequence Info:full length protein
