Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rubrivivax gelatinosus Light-harvesting protein B-800-850 alpha chain(pucA)

Recombinant Rubrivivax gelatinosus Light-harvesting protein B-800-850 alpha chain(pucA)

SKU:CSB-CF302886RHU

Regular price ¥253,100 JPY
Regular price Sale price ¥253,100 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Rubrivivax gelatinosus (Rhodocyclus gelatinosus) (Rhodopseudomonas gelatinosa)

Uniprot NO.:P77799

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNQGKVWRVVKPTVGVPVYLGAVAVTALILHGGLLAKTDWFGAYWNGGKKAAAAAAAVAP APVAAPQAPAQ

Protein Names:Recommended name: Light-harvesting protein B-800/850 alpha chain Alternative name(s): Antenna pigment protein alpha chain LH2 alpha polypeptide

Gene Names:Name:pucA

Expression Region:1-71

Sequence Info:full length protein

View full details