Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rickettsia typhi CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase(pgsA)

Recombinant Rickettsia typhi CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase(pgsA)

SKU:CSB-CF715088RNE

Regular price ¥273,300 JPY
Regular price Sale price ¥273,300 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rickettsia typhi (strain ATCC VR-144 / Wilmington)

Uniprot NO.:Q68XS5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKNLPNYLTIARIMVIPVIILLFYINNSLARKLGALLFVLASITDFFDGYIARKYNLVTS FGKMFDPIADKLLVGCVTIMLLKKDNVDEIPCLLILAREFLVSGLREFLALVKVSVPVSR LAKLKTFLQMFALSILILGSKGSGIIYLDIVGEIILWIAAFLTIITGYSYFKACKTYF

Protein Names:Recommended name: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase EC= 2.7.8.5

Gene Names:Name:pgsA Ordered Locus Names:RT0081

Expression Region:1-178

Sequence Info:full length protein

View full details