Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rickettsia prowazekii NAD(P) transhydrogenase subunit alpha part 2

Recombinant Rickettsia prowazekii NAD(P) transhydrogenase subunit alpha part 2

SKU:CSB-CF345959RMY

Regular price ¥263,600 JPY
Regular price Sale price ¥263,600 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Rickettsia prowazekii (strain Madrid E)

Uniprot NO.:P51995

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNQLPIMAKQAAEIASNAQELSNKLKDLVIDASWQTNTNTIDPLVFAITIFVLASFVGYY VVWKVTPALHTPLMSITNAISGIIVISSMIAITSSSAFEFSSLLGSFATLLASINIFGGF IVTTRMLEMFKK

Protein Names:Recommended name: NAD(P) transhydrogenase subunit alpha part 2 EC= 1.6.1.2 Alternative name(s): Nicotinamide nucleotide transhydrogenase subunit alpha 2 Pyridine nucleotide transhydrogenase subunit alpha 2

Gene Names:Name:pntAB Ordered Locus Names:RP862

Expression Region:1-132

Sequence Info:full length protein

View full details