Gene Bio Systems
Recombinant Rickettsia felis UPF0092 membrane protein RF_0958(RF_0958)
Recombinant Rickettsia felis UPF0092 membrane protein RF_0958(RF_0958)
SKU:CSB-CF706198RMT
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) (Rickettsia azadi)
Uniprot NO.:Q4UKW4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSANTQDNQANNNDTIEIQETEVVPVETNSLQSGLTSLTPMVLIFAVFYFLLLRPQEKRR KEREKLVSEVKKGEEVLTNSGIYGIVTKVSENDNNIEIEIAKDVRIKALKSAIVDITSRT KEVAVKKENNKKDKKVSGAKSS
Protein Names:Recommended name: UPF0092 membrane protein RF_0958
Gene Names:Ordered Locus Names:RF_0958
Expression Region:1-142
Sequence Info:full length protein
