Skip to product information
1 of 1

Gene Bio Systems

Recombinant Ricinus communis CASP-like protein RCOM_1174750 (RCOM_1174750)

Recombinant Ricinus communis CASP-like protein RCOM_1174750 (RCOM_1174750)

SKU:CSB-CF498704RMM

Regular price ¥270,700 JPY
Regular price Sale price ¥270,700 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Ricinus communis (Castor bean)

Uniprot NO.:B9RW00

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAKAKRVFTLLLRLIAFGTALVAAIVMATSHESGSFFTVSYEAKYSDTPAFKYFVIVNAI VTVYSFLALFLPSESLLWRLVIVTDVVFTMLVTSSISAAVAVAQVGKKGNSHAGWLPICG QVPKFCDQVTGALAAAFISLITYAILLLYSIHTVLNPLLLQKT

Protein Names:Recommended name: CASP-like protein RCOM_1174750

Gene Names:ORF Names:RCOM_1174750

Expression Region:1-163

Sequence Info:full length protein

View full details