Gene Bio Systems
Recombinant Rhodobacter sphaeroides UPF0060 membrane protein RSKD131_0092 (RSKD131_0092)
Recombinant Rhodobacter sphaeroides UPF0060 membrane protein RSKD131_0092 (RSKD131_0092)
SKU:CSB-CF497324RLH
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Rhodobacter sphaeroides (strain KD131 / KCTC 12085)
Uniprot NO.:B9KLG9
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MGLSLAAYAGAALAEIAGCFAVWAWWRLGASALWLVPGALSLGAFAWLLALTPVEVAGRS YAVYGGIYVAASLLWLWAVEGVRPDRWDMGGAALVLAGAAVILWAPRG
Protein Names:Recommended name: UPF0060 membrane protein RSKD131_0092
Gene Names:Ordered Locus Names:RSKD131_0092
Expression Region:1-108
Sequence Info:full length protein
