Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rhodobacter sphaeroides UPF0060 membrane protein RSKD131_0092 (RSKD131_0092)

Recombinant Rhodobacter sphaeroides UPF0060 membrane protein RSKD131_0092 (RSKD131_0092)

SKU:CSB-CF497324RLH

Regular price ¥260,000 JPY
Regular price Sale price ¥260,000 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Rhodobacter sphaeroides (strain KD131 / KCTC 12085)

Uniprot NO.:B9KLG9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGLSLAAYAGAALAEIAGCFAVWAWWRLGASALWLVPGALSLGAFAWLLALTPVEVAGRS YAVYGGIYVAASLLWLWAVEGVRPDRWDMGGAALVLAGAAVILWAPRG

Protein Names:Recommended name: UPF0060 membrane protein RSKD131_0092

Gene Names:Ordered Locus Names:RSKD131_0092

Expression Region:1-108

Sequence Info:full length protein

View full details