Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rhodobacter capsulatus Cobalt transport protein CbiQ(cbiQ)

Recombinant Rhodobacter capsulatus Cobalt transport protein CbiQ(cbiQ)

SKU:CSB-CF522146RLD

Regular price ¥277,900 JPY
Regular price Sale price ¥277,900 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)

Uniprot NO.:D5AUZ7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSIASIDRVAAQGRWRNRPLAEKCLIGLGFLALAVTVPPFPGAVLVTVAILAFTFLGARV PLRFWAAVAVLPLGFLTTGAAVLLIQIGPDGIGLAPQGPAKAAALVMRASAATCCLLFLA TTTPAADLLSGLRRWRVPAELIEIALLTYRFVFILAEEAAAMTTAQRARLGHATRRRWLR STAQVIAALLPRALDRARRLETGLAARNWQGEMRVLSTRPAASPLVLGLILTLQAAILAA GVLL

Protein Names:Recommended name: Cobalt transport protein CbiQ Alternative name(s): Energy-coupling factor transporter transmembrane protein CbiQ Short name= ECF transporter T component CbiQ

Gene Names:Name:cbiQ Synonyms:cbiQ2 Ordered Locus Names:RCAP_rcc02035

Expression Region:1-244

Sequence Info:full length protein

View full details