Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rhizobium sp. Probable intracellular septation protein A (NGR_c32310)

Recombinant Rhizobium sp. Probable intracellular septation protein A (NGR_c32310)

SKU:CSB-CF502250RKX

Regular price ¥272,600 JPY
Regular price Sale price ¥272,600 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rhizobium sp. (strain NGR234)

Uniprot NO.:C3MAH1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSTIEAEKPRTEVSPRLKLVLELGPLMVFFFANSRGDWLASRFPVLAELGGPIFIATGLF MAATATALIVSWIMTRTLPMMPLISGIVVFVFGALTLWLQNDTFIKMKPTIVNTLFGAIL LGGLLFGKSLLGYVFHAAFKLDEDGWRKLTIRWGVFFLFLAVLNEIVWRSFSTDFWVAFK VWGTMPITILFTLAQMPLIMKHSQERESAE

Protein Names:Recommended name: Probable intracellular septation protein A

Gene Names:Ordered Locus Names:NGR_c32310

Expression Region:1-210

Sequence Info:full length protein

View full details