Gene Bio Systems
Recombinant Rhizobium sp. Probable conjugal transfer protein trbD(trbD)
Recombinant Rhizobium sp. Probable conjugal transfer protein trbD(trbD)
SKU:CSB-CF345466RKX
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Rhizobium sp. (strain NGR234)
Uniprot NO.:P55397
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAEALSERYRNRIHRALSRPNLLMGADRELVLITGLAAVILIFVVLTVYSALFGVVVWIV IVGLLRMMAKSDPLMRQVYVRHISYKPYYKATTSPWRRY
Protein Names:Recommended name: Probable conjugal transfer protein trbD
Gene Names:Name:trbD Ordered Locus Names:NGR_a04190 ORF Names:y4cO
Expression Region:1-99
Sequence Info:full length protein
