Gene Bio Systems
Recombinant Rhizobium radiobacter Conjugal transfer protein trbC(trbC)
Recombinant Rhizobium radiobacter Conjugal transfer protein trbC(trbC)
SKU:CSB-CF346990RKV
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Rhizobium radiobacter (Agrobacterium tumefaciens) (Agrobacterium radiobacter)
Uniprot NO.:P54908
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSLKTHHTPIFTALALVALGSLDGALASSGGGSLPWESPLQQIQQSITGPVAGFIALAAV AIAGAMLIFGGELNDFARRLCYVALVGGVLLGATQIVALFGATGASIGELHSQVDPFGYS PSPKLIERGEGAHG
Protein Names:Recommended name: Conjugal transfer protein trbC
Gene Names:Name:trbC
Expression Region:1-134
Sequence Info:full length protein
