Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rhizobium meliloti UPF0700 transmembrane protein RA0705 (RA0705)

Recombinant Rhizobium meliloti UPF0700 transmembrane protein RA0705 (RA0705)

SKU:CSB-CF516239RKU

Regular price ¥272,600 JPY
Regular price Sale price ¥272,600 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)

Uniprot NO.:O31185

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTVQRRRRIIKRRRSSVGLALVAAISFLAGMTDAIGLMSIGDFVSFMSGNTTRASVALVQ GDAAQGLLLIGGLVSFVLGNAAGVMISIRFRPQAALLFVSALLACAALQEGQPELRFVSL IFAMGAVNASVEQIEGLPVGLTYVTGALSRFGRGLGRWAMGVRNTQWIIQIVPWLGMFAG AIMGAVLVREAGDLALWVPSLAALLLTAAAFQIPRRWQSRFIQSR

Protein Names:Recommended name: UPF0700 transmembrane protein RA0705

Gene Names:Ordered Locus Names:RA0705 ORF Names:SMa1297

Expression Region:1-225

Sequence Info:full length protein

View full details