Gene Bio Systems
Recombinant Rhizobium meliloti Nitrogen fixation protein fixH(fixH)
Recombinant Rhizobium meliloti Nitrogen fixation protein fixH(fixH)
SKU:CSB-CF322435RKU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)
Uniprot NO.:P18397
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSTATKQRSPKRGFTGWHMVAVMSLFFGTVISVNLVMAWNASRSWSGLVVENTYVASQQF NGKVAEGRAFQASGIKGRLTTEPGAIRYVLTRNGEPEQKIDKVIAVLKRPVEEHEDLRVE LHPRGEGAFVLAEELKPGQWIAAMMAMAGDAVVHRQTIRFIAEGRDK
Protein Names:Recommended name: Nitrogen fixation protein fixH
Gene Names:Name:fixH Ordered Locus Names:RA0660 ORF Names:SMa1210
Expression Region:1-167
Sequence Info:full length protein
