Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rhizobium etli Energy-coupling factor transporter transmembrane protein BioN(bioN)

Recombinant Rhizobium etli Energy-coupling factor transporter transmembrane protein BioN(bioN)

SKU:CSB-CF641580RKK

Regular price ¥277,600 JPY
Regular price Sale price ¥277,600 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Rhizobium etli (strain CFN 42 / ATCC 51251)

Uniprot NO.:Q2KBP6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MQSLYVEGNSRMHRLSPRAKLLSLTAFAILLFISHNLLLLSGAVLVAAVLYGTVGLPIGE ALLRLRPIFLTIAVVALFNLIFNPWQAALVPVLRLTALMLLAASVTATTTITEFIDEVTA LARPLERTGRVQADDIGLALGLVLRFVPEIVNRYQAIREAHKARGLKVRPTSLLAPLIIL TLKDADNVAAAIDARRIRRHGS

Protein Names:Recommended name: Energy-coupling factor transporter transmembrane protein BioN Short name= ECF transporter T component BioN

Gene Names:Name:bioN Ordered Locus Names:RHE_CH00929

Expression Region:1-202

Sequence Info:full length protein

View full details