Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Zinc transporter 1(Slc30a1)

Recombinant Rat Zinc transporter 1(Slc30a1)

SKU:CSB-CF723471RA

Regular price ¥270,300 JPY
Regular price Sale price ¥270,300 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:Q62720

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:YTTYPLLKESALILLQTVPKQIDIKHLVKELRDVEGVEEVHELHVWQLAGSRIIATAHIK CEDPASYMQVAKTIKDVFHNHGIHATTIQPEFASVGSKSSVVPCELACRTQCALKQCCGT RPQVHSGKEAEKAPTVSISCLELSENLEKKPRRTKAEGSVPAVVIEIKNVPNKQPESSL

Protein Names:Recommended name: Zinc transporter 1 Short name= ZnT-1 Alternative name(s): Solute carrier family 30 member 1

Gene Names:Name:Slc30a1 Synonyms:Znt1

Expression Region:329-507

Sequence Info:full length protein

View full details