Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Vitamin K epoxide reductase complex subunit 1-like protein 1(Vkorc1l1)

Recombinant Rat Vitamin K epoxide reductase complex subunit 1-like protein 1(Vkorc1l1)

SKU:CSB-CF747591RA

Regular price ¥271,900 JPY
Regular price Sale price ¥271,900 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:Q6TEK3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAAPVLLRVSVPRWERVARYAVCAAGILLSIYAYHVEREKERDPEHRALCDLGPWVKCSA ALASRWGRGFGLLGSIFGKDGVLNQPNSVFGLIFYILQLLLGMTASAVAALVLMTSSIVS VVGSLYLAYILYFVLKEFCIICVTTYVLNFLLLIINYKRLVYLNEAWKRQLQPKED

Protein Names:Recommended name: Vitamin K epoxide reductase complex subunit 1-like protein 1 Short name= VKORC1-like protein 1

Gene Names:Name:Vkorc1l1

Expression Region:1-176

Sequence Info:full length protein

View full details