Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Tumor necrosis factor receptor superfamily member 4(Tnfrsf4)

Recombinant Rat Tumor necrosis factor receptor superfamily member 4(Tnfrsf4)

SKU:CSB-CF023981RA

Regular price ¥281,600 JPY
Regular price Sale price ¥281,600 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:P15725

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:VTVKLNCVKDTYPSGHKCCRECQPGHGMVSRCDHTRDTVCHPCEPGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTEDTVCQCRPGTQPRQDSSHKLGVDCVPCPPGHFSPGSNQACKPWTNCTLSGKQIRHPASNSLDTVCEDRSLLATLLWETQRTTFRPTTVPSTTVWPRTSQLPSTPTLVAPEGPAFAVILGLGLGLLAPLTVLLALYLLRKAWRSPNTPKPCWGNSFRTPIQEEQTDTHFTLAKI

Protein Names:Recommended name: Tumor necrosis factor receptor superfamily member 4 Alternative name(s): MRC OX40 OX40 antigen OX40L receptor CD_antigen= CD134

Gene Names:Name:Tnfrsf4 Synonyms:Ox40, Txgp1l

Expression Region:20-271

Sequence Info:full length protein

View full details