Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Tumor necrosis factor ligand superfamily member 6(Faslg)

Recombinant Rat Tumor necrosis factor ligand superfamily member 6(Faslg)

SKU:CSB-CF008434RA

Regular price ¥286,300 JPY
Regular price Sale price ¥286,300 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:P36940

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MQQPVNYPCPQIYWVDSSATSPWAPPGSVFSCPSSGPRGPGQRRPPPPPPPPSPLPPPSQPPPLPPLSPLKKKDNIELWLPVIFFMVLVALVGMGLGMYQLFHLQKELAELREFTNHSLRVSSFEKQIANPSTPSETKKPRSVAHLTGNPRSRSIPLEWEDTYGTALISGVKYKKGGLVINEAGLYFVYSKVYFRGQSCNSQPLSHKVYMRNFKYPGDLVLMEEKKLNYCTTGQIWAHSSYLGAVFNLTVADHLYVNISQLSLINFEESKTFFGLYKL

Protein Names:Recommended name: Tumor necrosis factor ligand superfamily member 6 Alternative name(s): CD95 ligand Short name= CD95-L Fas antigen ligand Short name= Fas ligand Short name= FasL CD_antigen= CD178 Cleaved into the following 4 chains: 1. Tumor necrosis factor ligand superfamily member 6, membrane form 2. Tumor necrosis factor ligand superfamily member 6, soluble form Alternative name(s): Receptor-binding FasL ectodomain Soluble Fas ligand Short name= sFasL ADAM10-processed FasL form Short name= APL FasL intracellular domain Short name= FasL ICD Alternative name(s): SPPL2A-processed FasL form Short name= SPA

Gene Names:Name:Faslg Synonyms:Apt1Lg1, Cd95l, Fasl, Tnfsf6

Expression Region:1-278

Sequence Info:full length protein

View full details