Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Transmembrane protein 204(Tmem204)

Recombinant Rat Transmembrane protein 204(Tmem204)

SKU:CSB-CF023798RA

Regular price ¥281,000 JPY
Regular price Sale price ¥281,000 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:Q5M962

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTVQKLVATAVLVALVSLILNNAAAFTPNWVYQTLEDGRKRSVGLWKSCWLVDRGKGGTS PGTRTGQVDTHDCEVLGWGSESAGFQESRGTVKLQFDMMRACNLVATAALAVGQITFILG LTGLPLMSPESQCWEEAMAAAFQLASFVLVIGLVTFYRIGPYTNLSWSCYLNIGACLLAT LAAAMLIWNILHRREDCMAPRVIVISRSLTARFRRGLDNDYVESPC

Protein Names:Recommended name: Transmembrane protein 204 Alternative name(s): Claudin-like protein 24

Gene Names:Name:Tmem204 Synonyms:Clp24

Expression Region:1-226

Sequence Info:full length protein

View full details