Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Sodium-potassium-transporting ATPase subunit beta-1(Atp1b1)

Recombinant Rat Sodium-potassium-transporting ATPase subunit beta-1(Atp1b1)

SKU:CSB-CF002326RA

Regular price ¥296,200 JPY
Regular price Sale price ¥296,200 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:P07340

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MARGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISELKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIIRFLEKYKDSAQKDDMIFEDCGSMPSEPKERGEFNHERGERKVCRFKLDWLGNCSGLNDESYGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYPLTMKYNPNVLPVQCTGKRDEDKDKVGNIEYFGMGGFYGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTLDTEIRIECKAYGENIGYSEKDRFQGRFDVKIEVKS

Protein Names:Recommended name: Sodium/potassium-transporting ATPase subunit beta-1 Alternative name(s): Sodium/potassium-dependent ATPase subunit beta-1

Gene Names:Name:Atp1b1

Expression Region:1-304

Sequence Info:full length protein

View full details