Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Sclerostin(Sost)

Recombinant Rat Sclerostin(Sost)

SKU:CSB-EP859165RA

Regular price ¥147,200 JPY
Regular price Sale price ¥147,200 JPY
Sale Sold out
Shipping calculated at checkout.

Size:100ug. Other sizes are also available. For further information, please contact us.

Research Areas:Stem Cells

Uniprot ID:Q99P67

Gene Names:Sost

Organism:Rattus norvegicus (Rat)

AA Sequence:FKNDATEIIPGLREYPEPPQELENNQTMNRAENGGRPPHHPYDTKDVSEYSCRELHYTRFVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRVKWWRPNGPDFRCIPDRYRAQRVQLLCPGGAAPRSRKVRLVASCKCKRLTRFHNQSELKDFGPETARPQKGRKPRPRARGAKANQAELENAY

Expression Region:29-213aa

Sequence Info:Full Length of Mature Protein

Source:E.coli

Tag Info:N-terminal 10xHis-tagged and C-terminal Myc-tagged

MW:28.0 kDa

Alternative Name(s):Sost; Sclerostin

Relevance:Negative regulator of bone growth that acts through inhibition of Wnt signaling and bone formation.

Reference:"Noggin and sclerostin bone morphogenetic protein antagonists form a mutually inhibitory complex." Winkler D.G., Yu C., Geoghegan J.C., Ojala E.W., Skonier J.E., Shpektor D., Sutherland M.K., Latham J.A. J. Biol. Chem. 279:36293-36298(2004)

Purity:Greater than 90% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:Negative regulator of bone growth that acts through inhibition of Wnt signaling and bone formation.

Involvement in disease:

Subcellular Location:Secreted

Protein Families:Sclerostin family

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=Rn&CID=95369

KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?rno:80722

STRING Database Link:https://string-db.org/network/10116.ENSRNOP00000028238

OMIM Database Link:

Lead Time Guidance:3-7 business days

View full details