Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Ribosyldihydronicotinamide dehydrogenase(Nqo2)

Recombinant Rat Ribosyldihydronicotinamide dehydrogenase(Nqo2)

SKU:CSB-YP721470RA

Regular price ¥161,500 JPY
Regular price Sale price ¥161,500 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Others

Uniprot ID: Q6AY80

Gene Names: Nqo2

Organism: Rattus norvegicus (Rat)

AA Sequence: MAGKKVLLVYAHQEPKSFNGSMKQVAVEELSKQGCTVTVSDLYTMNFEPRATRNDVTGALSNPEVFKYGIEAYEAYKKKALTSDILEEQRKVQEADLVIFQFPLYWFSVPAILKGWMDRVLCQGFAFDVPGFYDSGFLKDKLALLSFTTGGTAEMYTKAGVNGDFRYFLWPLQHGTLHFCGFKVLAPQISFGPEVSSEEQRKVMLASWVQRLKSIWKEEPIHCTPSWYFQG

Expression Region: 1-231aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 28.3 kDa

Alternative Name(s): NRH dehydrogenase [quinone] 2NRH:quinone oxidoreductase 2Quinone reductase 2 ;QR2

Relevance: The enzyme apparently serves as a quinone reductase in connection with conjugation reactions of hydroquinones involved in detoxification pathways as well as in biosynthetic processes such as the vitamin K-dependent gamma-carboxylation of glutamate residues in prothrombin synthesis.

Reference: "Disruption of dihydronicotinamide riboside:quinone oxidoreductase 2 (NQO2) leads to myeloid hyperplasia of bone marrow and decreased sensitivity to menadione toxicity."Long D.J., Iskander K., Gaikwad A., Arin M., Roop D.R., Knox R., Barrios R., Jaiswal A.K.J. Biol. Chem. 277:46131-46139(2002)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details