Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Putative small membrane protein NID67(Nid67)

Recombinant Rat Putative small membrane protein NID67(Nid67)

SKU:CSB-CF860003RA

Regular price ¥216,600 JPY
Regular price Sale price ¥216,600 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:Q99PE6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDAISQSPVDVLLPKHILDIWAIVLIILATVVIMTSLFLCPATAVIIYRMRTHPVLNGAV

Protein Names:Recommended name: Putative small membrane protein NID67 Alternative name(s): NGF-induced differentiation clone 67 protein

Gene Names:Name:Nid67

Expression Region:1-60

Sequence Info:full length protein

View full details