Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Protein S100-A4(S100a4)

Recombinant Rat Protein S100-A4(S100a4)

SKU:CSB-EP020632RA

Regular price ¥184,300 JPY
Regular price Sale price ¥184,300 JPY
Sale Sold out
Shipping calculated at checkout.

Size:100ug. Other sizes are also available. For further information, please contact us.

Research Areas:Cardiovascular

Uniprot ID:P05942

Gene Names:S100a4

Organism:Rattus norvegicus (Rat)

AA Sequence:ARPLEEALDVIVSTFHKYSGNEGDKFKLNKTELKELLTRELPSFLGRRTDEAAFQKLMNNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGCPDKEPRKK

Expression Region:2-101aa

Sequence Info:Full Length of Mature Protein

Source:E.coli

Tag Info:N-terminal 10xHis-tagged and C-terminal Myc-tagged

MW:18.6 kDa

Alternative Name(s):Metastasin (Nerve growth factor-induced protein 42A) (P9K) (Placental calcium-binding protein) (S100 calcium-binding protein A4)

Relevance:

Reference:"Nerve growth factor induces the genes for two proteins related to a family of calcium-binding proteins in PC12 cells." Masiakowski P., Shooter E.M. Proc. Natl. Acad. Sci. U.S.A. 85:1277-1281(1988)

Purity:Greater than 85% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:S-100 family

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=Rn&CID=504

KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?rno:24615

STRING Database Link:https://string-db.org/network/10116.ENSRNOP00000015958

OMIM Database Link:

Lead Time Guidance:3-7 business days

View full details